Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVoltage-gated potassium channel subunit Kv4.3
LigandBDBM50160154
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1478659
IC50 316228±n/a nM
Citation Mirams GRDavies MRBrough SJBridgland-Taylor MHCui YGavaghan DJAbi-Gerges N Prediction of Thorough QT study results using action potential simulations based on ion channel screens. J Pharmacol Toxicol Methods 70:246-54 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Voltage-gated potassium channel subunit Kv4.3
Name:Voltage-gated potassium channel
Synonyms:Potassium voltage-gated channel subfamily D member 3 | Voltage-gated potassium channel subunit Kv4.3
Type:PROTEIN
Mol. Mass.:73464.62
Organism:Homo sapiens (Human)
Description:ChEMBL_1478652
Residue:655
Sequence:
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLER
YPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAF
YGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTST
LALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVE
YLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKF
SRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWY
TIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRR
AQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLL
HCLEKTTGLSYLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHP
GLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDG
LRPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSIASNVVKVSAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50160154
n/a
NameBDBM50160154
Synonyms:1-(3-Hydroxy-propyl)-5-((R)-2-{2-[2-(2,2,2-trifluoro-ethoxy)-phenoxy]-ethylamino}-propyl)-2,3-dihydro-1H-indole-7-carboxylic acid amide | CHEMBL24778 | SILODOSIN
TypeSmall organic molecule
Emp. Form.C25H32F3N3O4
Mol. Mass.495.5345
SMILESC[C@H](Cc1cc2CCN(CCCO)c2c(c1)C(N)=O)NCCOc1ccccc1OCC(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: