Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 2E1
LigandBDBM50088436
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1493681
Ki 9500000±n/a nM
Citation Harrelson JPStamper BDChapman JDGoodlett DRNelson SD Covalent modification and time-dependent inhibition of human CYP2E1 by the meta-isomer of acetaminophen. Drug Metab Dispos 40:1460-5 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 2E1
Name:Cytochrome P450 2E1
Synonyms:Cytochrome P450 2E1 (CYP2E1)
Type:Enzyme
Mol. Mass.:56860.34
Organism:Homo sapiens (Human)
Description:P05181
Residue:493
Sequence:
MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRL
AQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGP
TWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVI
ADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVA
EVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAG
TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRF
ITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGK
FKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGC
IPPRYKLCVIPRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50088436
n/a
NameBDBM50088436
Synonyms:BS-749 | CHEBI:76987 | METACETAMOL | Metacetamol
TypeSmall organic molecule
Emp. Form.C8H9NO2
Mol. Mass.151.1626
SMILESCC(=O)Nc1cccc(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: