Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 2E1
LigandBDBM50363928
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1487043
Ki>30000±n/a nM
Citation Foti RSPearson JTWong SLZalikowski JABoudreaux MDProkop SPDavis JABanfield CEmery MGRock DAWahlstrom JLWienkers LCAmore BM Predicting the drug interaction potential of AMG 853, a dual antagonist of the D-prostanoid and chemoattractant receptor-homologous molecule expressed on T helper 2 cells receptors. Drug Metab Dispos 40:2239-49 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 2E1
Name:Cytochrome P450 2E1
Synonyms:Cytochrome P450 2E1 (CYP2E1)
Type:Enzyme
Mol. Mass.:56860.34
Organism:Homo sapiens (Human)
Description:P05181
Residue:493
Sequence:
MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRL
AQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGP
TWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVI
ADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVA
EVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAG
TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRF
ITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGK
FKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGC
IPPRYKLCVIPRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50363928
n/a
NameBDBM50363928
Synonyms:CHEMBL1951575
TypeSmall organic molecule
Emp. Form.C28H27Cl2FN2O6S
Mol. Mass.609.493
SMILESCC(C)(C)NC(=O)c1ccc(Oc2cc(F)c(CC(O)=O)cc2Cl)c(NS(=O)(=O)c2ccc(cc2Cl)C2CC2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: