Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNuclear receptor subfamily 1 group I member 2
LigandBDBM50088493
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1487568
EC50 9000±n/a nM
Citation Shukla SJSakamuru SHuang RMoeller TAShinn PVanleer DAuld DSAustin CPXia M Identification of clinically used drugs that activate pregnane X receptors. Drug Metab Dispos 39:151-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nuclear receptor subfamily 1 group I member 2
Name:Nuclear receptor subfamily 1 group I member 2
Synonyms:Nr1i2 | Nuclear receptor subfamily 1 group I member 2 | Orphan nuclear receptor PXR | Pregnane X receptor | Pxr
Type:PROTEIN
Mol. Mass.:49664.53
Organism:Rattus norvegicus
Description:ChEMBL_105143
Residue:431
Sequence:
MRPEERWNHVGLVQREEADSVLEEPINVDEEDGGLQICRVCGDKANGYHFNVMTCEGCKG
FFRRAMKRNVRLRCPFRKGTCEITRKTRRQCQACRLRKCLESGMKKEMIMSDAAVEQRRA
LIKRKKREKIEAPPPGGQGLTEEQQALIQELMDAQMQTFDTTFSHFKDFRLPAVFHSDCE
LPEVLQASLLEDPATWSQIMKDSVPMKISVQLRGEDGSIWNYQPPSKSDGKEIIPLLPHL
ADVSTYMFKGVINFAKVISHFRELPIEDQISLLKGATFEMCILRFNTMFDTETGTWECGR
LAYCFEDPNGGFQKLLLDPLMKFHCMLKKLQLREEEYVLMQAISLFSPDRPGVVQRSVVD
QLQERFALTLKAYIECSRPYPAHRFLFLKIMAVLTELRSINAQQTQQLLRIQDTHPFATP
LMQELFSSTDG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50088493
n/a
NameBDBM50088493
Synonyms:DICLAZURIL | Diclazuril | R-64433
TypeSmall organic molecule
Emp. Form.C17H9Cl3N4O2
Mol. Mass.407.638
SMILESClc1ccc(cc1)C(C#N)c1c(Cl)cc(cc1Cl)-n1ncc(=O)[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: