Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPregnane X receptor (PXR)
LigandBDBM50103622
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1487565
EC50 31600±n/a nM
Citation Shukla SJSakamuru SHuang RMoeller TAShinn PVanleer DAuld DSAustin CPXia M Identification of clinically used drugs that activate pregnane X receptors. Drug Metab Dispos 39:151-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pregnane X receptor (PXR)
Name:Pregnane X receptor
Synonyms:Pregnane X Receptor | nuclear receptor subfamily 1 group I member 2 isoform 1
Type:Nuclear receptor
Mol. Mass.:49774.77
Organism:Homo sapiens (Human)
Description:O75469
Residue:434
Sequence:
MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEG
CKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEE
RRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSS
GCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLL
PHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWE
CGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHR
VVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPF
ATPLMQELFGITGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50103622
n/a
NameBDBM50103622
Synonyms:A-41-304 | CHEBI:691037 | DESOXIMETASONE | Desoximetasone | HOE-304 | R-2113 | Topicort | Topicort Lp
TypeSmall organic molecule
Emp. Form.C22H29FO4
Mol. Mass.376.4617
SMILES[H][C@@]12C[C@@H](C)[C@H](C(=O)CO)[C@@]1(C)C[C@H](O)[C@@]1(F)[C@@]2([H])CCC2=CC(=O)C=C[C@]12C |r,c:27,t:23|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: