Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSulfotransferase 1A1 (SULT1A1)
LigandBDBM17292
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1484210
Kd 2300±n/a nM
Citation Rohn KJCook ITLeyh TSKadlubar SAFalany CN Potent inhibition of human sulfotransferase 1A1 by 17a-ethinylestradiol: role of 3'-phosphoadenosine 5'-phosphosulfate binding and structural rearrangements in regulating inhibition and activity. Drug Metab Dispos 40:1588-95 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sulfotransferase 1A1 (SULT1A1)
Name:Sulfotransferase 1A1 (SULT1A1)
Synonyms:Aryl sulfotransferase 1 | HAST1/HAST2 | P-PST 1 | Phenol sulfotransferase 1 | Phenol-sulfating phenol sulfotransferase 1 | ST1A1 | ST1A3 | STP | STP1 | SULT1A1 | Sulfotransferase 1A1 | Thermostable phenol sulfotransferase | Ts-PST
Type:Enzyme
Mol. Mass.:34165.45
Organism:Homo sapiens (Human)
Description:P50225
Residue:295
Sequence:
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDM
IYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLD
QKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWW
ELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNY
TTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17292
n/a
NameBDBM17292
Synonyms:(1S,10R,11S,14S,15S)-15-methyltetracyclo[8.7.0.0^{2,7}.0^{11,15}]heptadeca-2,4,6-triene-5,14-diol | 17 beta-Estradiol | 17α-ethinylestradiol | 17beta-estradiol (E2) | CHEMBL135 | CS336 | ESTRADIOL | Estradiol-17 alpha | Ovocyclin | US9034854, E2 | US9040509, E2 | US9422324, E2 | US9561238, E2 | [2,4,6,7-3H]-17beta-estradiol | [2,4,6,7-3H]-E2 | [3H]-estradiol | [3H]]estradiol
TypeSteroid
Emp. Form.C18H24O2
Mol. Mass.272.382
SMILES[H][C@@]12CC[C@H](O)[C@@]1(C)CC[C@]1([H])c3ccc(O)cc3CC[C@@]21[H]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: