Reaction Details |
| Report a problem with these data |
Target | Sulfotransferase 1A1 |
---|
Ligand | BDBM17292 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1484211 (CHEMBL3537872) |
---|
Kd | 1200±n/a nM |
---|
Citation | Rohn, KJ; Cook, IT; Leyh, TS; Kadlubar, SA; Falany, CN Potent inhibition of human sulfotransferase 1A1 by 17a-ethinylestradiol: role of 3'-phosphoadenosine 5'-phosphosulfate binding and structural rearrangements in regulating inhibition and activity. Drug Metab Dispos40:1588-95 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sulfotransferase 1A1 |
---|
Name: | Sulfotransferase 1A1 |
Synonyms: | Aryl sulfotransferase 1 | HAST1/HAST2 | P-PST 1 | Phenol sulfotransferase 1 | Phenol-sulfating phenol sulfotransferase 1 | ST1A1 | ST1A1_HUMAN | ST1A3 | STP | STP | STP1 | SULT1A1 | Sulfotransferase 1A1 | Sulfotransferase 1A1 (SULT1A1) | Thermostable phenol sulfotransferase | Ts-PST |
Type: | Enzyme |
Mol. Mass.: | 34165.45 |
Organism: | Homo sapiens (Human) |
Description: | P50225 |
Residue: | 295 |
Sequence: | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDM
IYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLD
QKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWW
ELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNY
TTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
|
|
|
BDBM17292 |
---|
n/a |
---|
Name | BDBM17292 |
Synonyms: | (1S,10R,11S,14S,15S)-15-methyltetracyclo[8.7.0.0^{2,7}.0^{11,15}]heptadeca-2,4,6-triene-5,14-diol | 17 beta-Estradiol | 17α-ethinylestradiol | 17beta-estradiol (E2) | CHEMBL135 | CS336 | ESTRADIOL | Estradiol-17 alpha | Ovocyclin | US9034854, E2 | US9040509, E2 | US9422324, E2 | US9561238, E2 | [2,4,6,7-3H]-17beta-estradiol | [2,4,6,7-3H]-E2 | [3H]-estradiol | [3H]]estradiol |
Type | Steroid |
Emp. Form. | C18H24O2 |
Mol. Mass. | 272.382 |
SMILES | [H][C@@]12CC[C@H](O)[C@@]1(C)CC[C@]1([H])c3ccc(O)cc3CC[C@@]21[H] |
Structure |
|