Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKynurenine 3-monooxygenase
LigandBDBM50061916
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1487467
IC50 90±n/a nM
Citation Beconi MGYates DLyons KMatthews KClifton SMead TPrime MWinkler DO'Connell CWalter DToledo-Sherman LMunoz-Sanjuan IDominguez C Metabolism and pharmacokinetics of JM6 in mice: JM6 is not a prodrug for Ro-61-8048. Drug Metab Dispos 40:2297-306 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kynurenine 3-monooxygenase
Name:Kynurenine 3-monooxygenase
Synonyms:Kmo | Kynurenine 3-hydroxylase | Kynurenine 3-monooxygenase
Type:PROTEIN
Mol. Mass.:54550.12
Organism:Mus musculus
Description:ChEMBL_109577
Residue:479
Sequence:
MASSDTQGKRVAVIGGGLVGALNACFLAKRNFQVDVYEAREDIRVAKSARGRSINLALSY
RGRQALKAIGLEDQIVSKGVPMKARMIHSLSGKKSAIPYGNKSQYILSISRENLNKDLLT
AVESYANAKVHFGHKLSKCIPEEGVLTVLGPDKVPRDVTCDLVVGCDGAYSTVRAHLMKK
PRFDYTQQYIPHGYMELTIPPKNGEYAMEPNCLHIWPRNAYMMIALPNMDKSFTCTLFMP
FEEFERLPTRSDVLDFFQKNFPDAIPLMGEQALMRDFFLLPAQPMISVKCSPFHLKSHCV
LMGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNNLSMCLPEFSRFRIPDDHAISDLS
MYNYIEMRAHVNSRWFLFQKLLDKFLHAIMPSTFIPLYTMVAFTRIRYHEAVLRWHWQKK
VINRGLFVLGSLIAIGGTYLLVHHLSLRPLEFLRRPAWMGTTGYWTRSTDISLQVPWSY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50061916
n/a
NameBDBM50061916
Synonyms:3,4-Dimethoxy-N-[4-(3-nitro-phenyl)-thiazol-2-yl]-benzenesulfonamide | CHEMBL134915
TypeSmall organic molecule
Emp. Form.C17H15N3O6S2
Mol. Mass.421.448
SMILESCOc1ccc(cc1OC)S(=O)(=O)Nc1nc(cs1)-c1cccc(c1)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: