| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Ligand | BDBM50089449 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1496953 (CHEMBL3579427) |
|---|
| Ki | 30±n/a nM |
|---|
| Citation |  Eng, WS; Hocková, D; ?pacek, P; Janeba, Z; West, NP; Woods, K; Naesens, LM; Keough, DT; Guddat, LW First Crystal Structures of Mycobacterium tuberculosis 6-Oxopurine Phosphoribosyltransferase: Complexes with GMP and Pyrophosphate and with Acyclic Nucleoside Phosphonates Whose Prodrugs Have Antituberculosis Activity. J Med Chem58:4822-38 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Name: | Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Synonyms: | HGPRT | HGPRTase | HPRT | HPRT1 | HPRT_HUMAN | Hypoxanthine-guanine phosphoribosyltransferase | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 24579.61 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00492 |
|---|
| Residue: | 218 |
|---|
| Sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
|
|
|
|---|
| BDBM50089449 |
|---|
| n/a |
|---|
| Name | BDBM50089449 |
|---|
| Synonyms: | CHEMBL3578114 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H30N7O10P3 |
|---|
| Mol. Mass. | 561.3609 |
|---|
| SMILES | Nc1nc2n(CCN(CCN(CCP(O)(O)=O)CCP(O)(O)=O)CCP(O)(O)=O)cnc2c(=O)[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
