Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSRC
LigandBDBM50089575
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1497041
Ki 70±n/a nM
Citation Tintori CLa Sala GVignaroli GBotta LFallacara ALFalchi FRadi MZamperini CDreassi EDello Iacono LOrioli DBiamonti GGarbelli MLossani AGasparrini FTuccinardi TLaurenzana IAngelucci AMaga GSchenone SBrullo CMusumeci FDesogus ACrespan EBotta M Studies on the ATP Binding Site of Fyn Kinase for the Identification of New Inhibitors and Their Evaluation as Potential Agents against Tauopathies and Tumors. J Med Chem 58:4590-609 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
SRC
Name:SRC
Synonyms:5-HT6 | FYN | HTR6 | Tyrosine Kinase FYN | Tyrosine-protein kinase Fyn | Tyrosine-protein kinase Fyn (Fyn)
Type:Enzyme
Mol. Mass.:60762.21
Organism:Homo sapiens (Human)
Description:P06241
Residue:537
Sequence:
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50089575
n/a
NameBDBM50089575
Synonyms:CHEMBL3578214
TypeSmall organic molecule
Emp. Form.C19H15Cl2N5
Mol. Mass.384.262
SMILESNc1ncnc2n(CC(Cl)c3ccccc3)nc(-c3ccc(Cl)cc3)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: