Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBDNF/NT-3 growth factors receptor
LigandBDBM50092090
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1498686
IC50 21±n/a nM
Citation Choi HSRucker PVWang ZFan YAlbaugh PChopiuk GGessier FSun FAdrian FLiu GHood TLi NJia YChe JMcCormack SLi ALi JSteffy ACulazzo ATompkins CPhung VKreusch ALu MHu BChaudhary APrashad MTuntland TLiu BHarris JSeidel HMLoren JMolteni V (R)-2-Phenylpyrrolidine Substituted Imidazopyridazines: A New Class of Potent and Selective Pan-TRK Inhibitors. ACS Med Chem Lett 6:562-7 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
BDNF/NT-3 growth factors receptor
Name:Neurotrophic tyrosine kinase receptor
Synonyms:GP145-TrkB | NTRK2 | Neurotrophic tyrosine kinase receptor type 2 | TRKB | Trk-B | TrkB tyrosine kinase | Tropomyosin-related kinase B | Tropomyosin-related kinase B (TRKB) | Tyrosine kinase receptor B (Trk-B)
Type:Enzyme
Mol. Mass.:91996.87
Organism:Homo sapiens (Human)
Description:Q16620
Residue:822
Sequence:
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEP
NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISNDDDSASP
LHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVL
KRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHI
VKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQI
AAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWM
PPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQ
EVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50092090
n/a
NameBDBM50092090
Synonyms:CHEMBL3582429
TypeSmall organic molecule
Emp. Form.C20H14FN5
Mol. Mass.343.3571
SMILESFc1cccc(CNc2ccc3ncc(-c4ccc(cc4)C#N)n3n2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: