Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 11B1, mitochondrial
LigandBDBM50092190
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1498858
IC50 18±n/a nM
Citation Hoyt SBPark MKLondon CXiong YTata JBennett DJCooke ACai JCarswell ERobinson JMacLean JBrown LBelshaw SClarkson TRLiu KLiang GBStruthers MCully DWisniewski TRen NBopp CSok ACai TQStribling SPai LYMa XMetzger JVerras AMcMasters DChen QTung ETang WSalituro GBuist NKuethe JRivera NClemas JZhou GGibson JMaxwell CALassman MMcLaughlin TCastro-Perez JSzeto DForrest GHajdu RRosenbach MAli A Discovery of Benzimidazole CYP11B2 Inhibitors with in Vivo Activity in Rhesus Monkeys. ACS Med Chem Lett 6:573-8 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 11B1, mitochondrial
Name:Cytochrome P450 11B1
Synonyms:CYPXIB1 | Cytochrome P450 11B, mitochondrial precursor | Cytochrome P450 11B1 | Cytochrome P450 11B1 (CYP11B1)
Type:Enzyme
Mol. Mass.:57591.44
Organism:Homo sapiens (Human)
Description:P15538
Residue:503
Sequence:
MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQG
YEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELS
PDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRP
ERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQED
IKMVYSFILRPSMFPLLTFRAIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50092190
n/a
NameBDBM50092190
Synonyms:CHEMBL3582482
TypeSmall organic molecule
Emp. Form.C17H15F2N3
Mol. Mass.299.3179
SMILESCc1cncc(-c2nc3cc(F)c(F)cc3n2C2CC2)c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: