Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 11B2 (CYP11B2)
LigandBDBM50092191
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1498857
IC50 0.600000±n/a nM
Citation Hoyt SBPark MKLondon CXiong YTata JBennett DJCooke ACai JCarswell ERobinson JMacLean JBrown LBelshaw SClarkson TRLiu KLiang GBStruthers MCully DWisniewski TRen NBopp CSok ACai TQStribling SPai LYMa XMetzger JVerras AMcMasters DChen QTung ETang WSalituro GBuist NKuethe JRivera NClemas JZhou GGibson JMaxwell CALassman MMcLaughlin TCastro-Perez JSzeto DForrest GHajdu RRosenbach MAli A Discovery of Benzimidazole CYP11B2 Inhibitors with in Vivo Activity in Rhesus Monkeys. ACS Med Chem Lett 6:573-8 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 11B2 (CYP11B2)
Name:Cytochrome P450 11B2
Synonyms:Aldosterone Synthase (CYP11B2) | Aldosterone synthase | Aldosterone-synthesizing enzyme | CYPXIB2 | Cytochrome P450 11B2 | Cytochrome P450 11B2, mitochondrial | P-450Aldo | P-450C18 | Steroid 18-hydroxylase
Type:Protein
Mol. Mass.:57582.15
Organism:Homo sapiens (Human)
Description:P19099
Residue:503
Sequence:
MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQG
YEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELS
LEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRP
ERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQED
IKMVYSFILRPGTSPLLTFRAIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50092191
n/a
NameBDBM50092191
Synonyms:CHEMBL3582483
TypeSmall organic molecule
Emp. Form.C17H15F2N3O
Mol. Mass.315.3173
SMILESCOc1c(C)cncc1-c1nc2cc(F)c(F)cc2n1C1CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: