Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProlyl 4-hydroxylase subunit alpha-1
LigandBDBM50042876
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1500972
pH7.8±n/a
IC50 840±n/a nM
Commentsextracted
Citation Vasta JDRaines RT Selective inhibition of prolyl 4-hydroxylases by bipyridinedicarboxylates. Bioorg Med Chem 23:3081-90 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prolyl 4-hydroxylase subunit alpha-1
Name:Prolyl 4-hydroxylase subunit alpha-1
Synonyms:4-PH alpha-1 | P4HA | P4HA1 | Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-1 | Prolyl 4-hydroxylase subunit alpha-1
Type:PROTEIN
Mol. Mass.:61043.51
Organism:Homo sapiens (Human)
Description:ChEMBL_103483
Residue:534
Sequence:
MIWYILIIGILLPQSLAHPGFFTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWA
EKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQY
FPNDEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSFLTAEDCFELGKVAYTEADY
YHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQR
ANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKGVAVDYLPERQKYEMLCRGEGIKM
TPRRQKKLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRFHDIISDAEIEIVKDLAKPRL
RRATISNPITGDLETVHYRISKSAWLSGYENPVVSRINMRIQDLTGLDVSTAEELQVANY
GVGGQYEPHFDFARKDEPDAFKELGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKG
TAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWLHERGQEFRRPCTLSELE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50042876
n/a
NameBDBM50042876
Synonyms:CHEMBL332005 | [2,2']Bipyridinyl-5,5'-dicarboxylic acid
TypeSmall organic molecule
Emp. Form.C12H8N2O4
Mol. Mass.244.2029
SMILESOC(=O)c1ccc(nc1)-c1ccc(cn1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: