Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFormyl peptide receptor 1
LigandBDBM50097559
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1504342
EC50 950±n/a nM
Citation Lacivita ESchepetkin IAStama MLKirpotina LNColabufo NAPerrone RKhlebnikov AIQuinn MTLeopoldo M Novel 3-(1H-indol-3-yl)-2-[3-(4-methoxyphenyl)ureido]propanamides as selective agonists of human formyl-peptide receptor 2. Bioorg Med Chem 23:3913-24 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Formyl peptide receptor 1
Name:fMet-Leu-Phe receptor 1/2
Synonyms:Formyl peptide Receptor | formyl peptide receptor 1
Type:Enzyme Catalytic Domain
Mol. Mass.:38456.14
Organism:Homo sapiens (Human)
Description:gi_4503779
Residue:350
Sequence:
METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVT
TISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIA
LDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNF
SPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPL
RVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML
YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50097559
n/a
NameBDBM50097559
Synonyms:CHEMBL3590073
TypeSmall organic molecule
Emp. Form.C31H35N5O3
Mol. Mass.525.6413
SMILESCOc1ccc(NC(=O)N[C@@H](Cc2c[nH]c3ccccc23)C(=O)NCC2(CCCCC2)c2ccccn2)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: