Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGPR24
LigandBDBM50094885
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1502790
Ki 3.8±n/a nM
Citation Devasthale PWang WHernandez ASMoore FRenduchintala KSridhar RPelleymounter MALonghi DHuang NFlynn NAzzara AVRohrbach KDevenny JRooney SThomas MGlick SGodonis HHarvey SCullen MJZhang HCaporuscio CStetsko PGrubb MHuang CZhang LFreeden CLi YXMurphy BJRobl JAWashburn WN Dihydropyrrolopyrazol-6-one MCHR1 antagonists for the treatment of obesity: Insights on in vivo efficacy from a novel FLIPR assay setup. Bioorg Med Chem Lett 25:2793-9 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GPR24
Name:GPR24
Synonyms:Melanin Concentrating Hormone 1 | Melanin-concentrating hormone receptor | Melanin-concentrating hormone receptor 1
Type:Enzyme Catalytic Domain
Mol. Mass.:39740.39
Organism:RAT
Description:Melanin Concentrating Hormone 1 GPR24 RAT::P97639
Residue:360
Sequence:
QATCTGCMDLQTSLLSTGPNASNISDGQDNLTLPGSPPRTGSVSYINIIMPSVFGTICLL
GIVGNSTVIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGE
TMCTLITAMDANSQFTSTYILTAMTIDRYLATVHPISSTKFRKPSMATLVICLLWALSFI
SITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVKILQ
RMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLY
NAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTESKGT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50094885
n/a
NameBDBM50094885
Synonyms:CHEMBL3588863
TypeSmall organic molecule
Emp. Form.C24H25ClN4O5
Mol. Mass.484.932
SMILESCOc1cc(ccc1OCC(C)(C)OC(=O)CN)N1Cc2cn(nc2C1=O)-c1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: