Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein arginine methyltransferase 8 (PRMT8)
LigandBDBM50095348
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1504109
IC50 23±n/a nM
Citation Mitchell LHDrew AERibich SARioux NSwinger KKJacques SLLingaraj TBoriack-Sjodin PAWaters NJWigle TJMoradei OJin LRiera TPorter-Scott MMoyer MPSmith JJChesworth RCopeland RA Aryl Pyrazoles as Potent Inhibitors of Arginine Methyltransferases: Identification of the First PRMT6 Tool Compound. ACS Med Chem Lett 6:655-9 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein arginine methyltransferase 8 (PRMT8)
Name:Protein arginine N-methyltransferase 8
Synonyms:HRMT1L3 | HRMT1L4 | Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4 | PRMT8 | Protein arginine N-methyltransferase 8 | Protein arginine N-methyltransferase 8 (PRMT8)
Type:Protein
Mol. Mass.:45293.70
Organism:Homo sapiens (Human)
Description:n/a
Residue:394
Sequence:
MGMKHSSRCLLLRRKMAENAAESTEVNSPPSQPPQPVVPAKPVQCVHHVSTQPSCPGRGK
MSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGS
GTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVD
IIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWE
NVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQR
NDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISM
KPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50095348
n/a
NameBDBM50095348
Synonyms:CHEMBL3589036
TypeSmall organic molecule
Emp. Form.C23H27F3N4O
Mol. Mass.432.4819
SMILESCNCCN(C)Cc1cn[nH]c1-c1cc(OCCc2ccccc2)cc(c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: