Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-1 receptor-associated kinase 4
LigandBDBM50095475
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1504266
IC50 0.200000±n/a nM
Citation Lim JAltman MDBaker JBrubaker JDChen HChen YFischmann TGibeau CKleinschek MALeccese ELesburg CMaclean JKMoy LYMulrooney EFPresland JRakhilina LSmith GFSteinhuebel DYang R Discovery of 5-Amino-N-(1H-pyrazol-4-yl)pyrazolo[1,5-a]pyrimidine-3-carboxamide Inhibitors of IRAK4. ACS Med Chem Lett 6:683-8 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Interleukin-1 receptor-associated kinase 4
Name:Interleukin-1 receptor-associated kinase 4
Synonyms:IRAK-4 | Interleukin-1 receptor-associated kinase 4 (IRAK-4) | Interleukin-1 receptor-associated kinase 4 (IRAK4) | Renal carcinoma antigen NY-REN-64
Type:Protein
Mol. Mass.:51519.08
Organism:Homo sapiens (Human)
Description:Q9NWZ3
Residue:460
Sequence:
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITV
QQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN
FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50095475
n/a
NameBDBM50095475
Synonyms:CHEMBL3590479
TypeSmall organic molecule
Emp. Form.C18H22F2N8O
Mol. Mass.404.4171
SMILESCn1cc(NC(=O)c2cnn3ccc(N[C@@H]4CCCC[C@@H]4N)nc23)c(n1)C(F)F |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: