| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Vitamin K-dependent protein C |
|---|
| Ligand | BDBM50096792 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1499041 (CHEMBL3584638) |
|---|
| Ki | >54000±n/a nM |
|---|
| Citation |  Hu, Z; Wong, PC; Gilligan, PJ; Han, W; Pabbisetty, KB; Bozarth, JM; Crain, EJ; Harper, T; Luettgen, JM; Myers, JE; Ramamurthy, V; Rossi, KA; Sheriff, S; Watson, CA; Wei, A; Zheng, JJ; Seiffert, DA; Wexler, RR; Quan, ML Discovery of a Potent Parenterally Administered Factor XIa Inhibitor with Hydroxyquinolin-2(1H)-one as the P2' Moiety. ACS Med Chem Lett6:590-5 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Vitamin K-dependent protein C |
|---|
| Name: | Vitamin K-dependent protein C |
|---|
| Synonyms: | Activated protein C cofactor | Anticoagulant protein C | Apolipoprotein H | Autoprothrombin IIA | Blood coagulation factor XIV | Coagulation factor V | Coagulation factor V heavy chain | Coagulation factor V light chain | Endothelial protein C receptor | PROC | PROC_HUMAN | Proaccelerin, labile factor | Vitamin K-dependent protein C precursor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 52067.73 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 461 |
|---|
| Sequence: | MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECI
EEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSC
DCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVK
FPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGA
VLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDI
ALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVL
NFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLV
SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP
|
|
|
|---|
| BDBM50096792 |
|---|
| n/a |
|---|
| Name | BDBM50096792 |
|---|
| Synonyms: | CHEMBL3580759 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H28Cl2N10O4 |
|---|
| Mol. Mass. | 663.514 |
|---|
| SMILES | CN1CCN(CC1)C(=O)C[C@H](NC(=O)\C=C\c1cc(Cl)ccc1-n1cnnn1)c1nc(c(Cl)[nH]1)-c1ccc2[nH]c(=O)cc(O)c2c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
