Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein kinase CLK2
LigandBDBM50097855
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1502246
IC50 110±n/a nM
Citation Falke HChaikuad ABecker ALoac NLozach OAbu Jhaisha SBecker WJones PGPreu LBaumann KKnapp SMeijer LKunick C 10-iodo-11H-indolo[3,2-c]quinoline-6-carboxylic acids are selective inhibitors of DYRK1A. J Med Chem 58:3131-43 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificity protein kinase CLK2
Name:Dual specificity protein kinase CLK2
Synonyms:CDC-like kinase 2
Type:PROTEIN
Mol. Mass.:60021.57
Organism:Mus musculus
Description:ChEMBL_1502246
Residue:499
Sequence:
MPHPRRYHSSERGSRGSYHEHYQSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYD
DHSSDRRLYDRRYCGSYRRNDYSRDRGEAYYDTDFRQSYEYHRENSSYRSQRSSRRKHRR
RRRRSRTFSRSSSHSSRRAKSVEDDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCV
DHRRGGTQVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCI
SFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNS
DYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQP
CDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPVPSRMIRKTRKQKYFYRGRLDW
DENTSAGRYVRENCKPLRRYLTSEAEDHHQLFDLIENMLEYEPAKRLTLGEALQHPFFAC
LRTEPPNTKLWDSSRDISR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50097855
n/a
NameBDBM50097855
Synonyms:CHEMBL3589666
TypeSmall organic molecule
Emp. Form.C17H11BrN2O3
Mol. Mass.371.185
SMILESCOc1ccc2c3[nH]c4c(Br)cccc4c3c(nc2c1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: