Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase 9
LigandBDBM50097860
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1502244
IC50 2200±n/a nM
Citation Falke HChaikuad ABecker ALoac NLozach OAbu Jhaisha SBecker WJones PGPreu LBaumann KKnapp SMeijer LKunick C 10-iodo-11H-indolo[3,2-c]quinoline-6-carboxylic acids are selective inhibitors of DYRK1A. J Med Chem 58:3131-43 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-dependent kinase 9
Name:Cyclin-dependent kinase 9
Synonyms:C-2K | CDC2L4 | CDK9 | Cell division cycle 2-like protein kinase 4 | Cell division protein kinase 9 | Cyclin-Dependent Kinase 9 (CDK9) | Cyclin-dependent kinase 9 (CDK9) | Serine/threonine-protein kinase PITALRE | TAK | Tat-associated kinase complex catalytic subunit
Type:Enzyme Subunit
Mol. Mass.:42789.13
Organism:Homo sapiens (Human)
Description:n/a
Residue:372
Sequence:
MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFP
ITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVK
FTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNS
QPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLAL
ISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDP
AQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNP
ATTNQTEFERVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50097860
n/a
NameBDBM50097860
Synonyms:CHEMBL3589671
TypeSmall organic molecule
Emp. Form.C16H8ClIN2O2
Mol. Mass.422.604
SMILESOC(=O)c1nc2ccc(I)cc2c2[nH]c3c(Cl)cccc3c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: