Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetN-formyl peptide receptor 2
LigandBDBM50098177
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1502490
EC50 40±n/a nM
Citation Stepniewski TMFilipek S Non-peptide ligand binding to the formyl peptide receptor FPR2--A comparison to peptide ligand binding modes. Bioorg Med Chem 23:4072-81 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
N-formyl peptide receptor 2
Name:N-formyl peptide receptor 2
Synonyms:ALXR, FPRL1, FPR2 | FMLP-related receptor I FMLP-R-I | Formyl Peptide Receptor-Like 1 | HM63 | LXA4 receptor | Lipoxin A4 receptor | Lipoxin A4 receptor (LXA4) | RFP | hFPRL
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:38968.35
Organism:Homo sapiens (Human)
Description:n/a
Residue:351
Sequence:
METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50098177
n/a
NameBDBM50098177
Synonyms:CHEMBL3588926
TypeSmall organic molecule
Emp. Form.C21H24BrN3O2
Mol. Mass.430.338
SMILESBrc1ccc(NC(=O)N[C@@H](Cc2ccccc2)C(=O)N2CCCCC2)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: