| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50012477 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1456841 (CHEMBL3367574) |
|---|
| Ki | 0.024000±n/a nM |
|---|
| Citation |  Weltrowska, G; Lemieux, C; Chung, NN; Guo, JJ; Wilkes, BC; Schiller, PW 'Carba'-carfentanil (trans isomer): aµ opioid receptor (MOR) partial agonist with a distinct binding mode. Bioorg Med Chem22:4581-6 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | MOR-1 | MUOR1 | Mu-type opioid receptor (MOR) | OPIATE Mu | OPRM_RAT | Opiate non-selective | Opioid receptor B | Oprm1 | Ror-b |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44503.11 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor. |
|---|
| Residue: | 398 |
|---|
| Sequence: | MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
|
|
|
|---|
| BDBM50012477 |
|---|
| n/a |
|---|
| Name | BDBM50012477 |
|---|
| Synonyms: | 1-Phenethyl-4-(phenyl-propionyl-amino)-piperidine-4-carboxylic acid methyl ester | 1-Phenethyl-4-(phenyl-propionyl-amino)-piperidine-4-carboxylic acid methyl ester(Carefentanil) | CARFENTANIL | CHEMBL290429 | Carfentanil1-Phenethyl-4-(phenyl-propionyl-amino)-piperidine-4-carboxylic acid methyl ester | US20230399418, Compound Carfentanil |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H30N2O3 |
|---|
| Mol. Mass. | 394.5066 |
|---|
| SMILES | CCC(=O)N(c1ccccc1)C1(CCN(CCc2ccccc2)CC1)C(=O)OC |
|---|
| Structure | 
|
|---|
Search and Browse
