Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 2J2
LigandBDBM78577
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1485701
IC50 11500±n/a nM
Citation Ren SZeng JMei YZhang JZYan SFFei JChen L Discovery and characterization of novel, potent, and selective cytochrome P450 2J2 inhibitors. Drug Metab Dispos 41:60-71 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 2J2
Name:Cytochrome P450 2J2
Synonyms:n/a
Type:Enzyme
Mol. Mass.:57623.04
Organism:Homo sapiens (Human)
Description:P51589
Residue:502
Sequence:
MLAAMGSLAAALWAVVHPRTLLLGTVAFLLAADFLKRRRPKNYPPGPWRLPFLGNFFLVD
FEQSHLEVQLFVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHI
FKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDP
HFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASKTCQLYNVFPWIMKFL
PGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDAYLKEMSKHTGNPTSSFHEEN
LICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAARESMP
YTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDT
FNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLS
LKFRMGITISPVSHRLCAVPQV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM78577
n/a
NameBDBM78577
Synonyms:BEPRIDIL | BEPRIDIL HYDROCHLORIDE | Bepridil | MLS000028456 | N-[3-(2-methylpropoxy)-2-(1-pyrrolidinyl)propyl]-N-(phenylmethyl)aniline;hydrochloride | N-[3-(2-methylpropoxy)-2-pyrrolidin-1-yl-propyl]-N-(phenylmethyl)aniline;hydrochloride | N-benzyl-N-[3-(2-methylpropoxy)-2-pyrrolidin-1-ylpropyl]aniline;hydrochloride | SMR000058419 | benzyl-(3-isobutoxy-2-pyrrolidino-propyl)-phenyl-amine;hydrochloride | cid_50088
TypeSmall organic molecule
Emp. Form.C24H34N2O
Mol. Mass.366.5396
SMILESCC(C)COCC(CN(Cc1ccccc1)c1ccccc1)N1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: