Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50104785 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1508094 (CHEMBL3599695) |
---|
Ki | 3.1±n/a nM |
---|
Citation | Barresi, E; Bruno, A; Taliani, S; Cosconati, S; Da Pozzo, E; Salerno, S; Simorini, F; Daniele, S; Giacomelli, C; Marini, AM; La Motta, C; Marinelli, L; Cosimelli, B; Novellino, E; Greco, G; Da Settimo, F; Martini, C Deepening the Topology of the Translocator Protein Binding Site by Novel N,N-Dialkyl-2-arylindol-3-ylglyoxylamides. J Med Chem58:6081-92 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50104785 |
---|
n/a |
---|
Name | BDBM50104785 |
Synonyms: | CHEMBL3597368 |
Type | Small organic molecule |
Emp. Form. | C24H26N2O4 |
Mol. Mass. | 406.4742 |
SMILES | CCCN(CCC)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccc(cc1)C(=O)OC |
Structure |
|