Reaction Details |
| Report a problem with these data |
Target | Cysteinyl leukotriene receptor 2 |
---|
Ligand | BDBM50104911 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1506283 (CHEMBL3599261) |
---|
IC50 | 5.5±n/a nM |
---|
Citation | Itadani, S; Yashiro, K; Aratani, Y; Sekiguchi, T; Kinoshita, A; Moriguchi, H; Ohta, N; Takahashi, S; Ishida, A; Tajima, Y; Hisaichi, K; Ima, M; Ueda, J; Egashira, H; Sekioka, T; Kadode, M; Yonetomi, Y; Nakao, T; Inoue, A; Nomura, H; Kitamine, T; Fujita, M; Nabe, T; Yamaura, Y; Matsumura, N; Imagawa, A; Nakayama, Y; Takeuchi, J; Ohmoto, K Discovery of Gemilukast (ONO-6950), a Dual CysLT1 and CysLT2 Antagonist As a Therapeutic Agent for Asthma. J Med Chem58:6093-113 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cysteinyl leukotriene receptor 2 |
---|
Name: | Cysteinyl leukotriene receptor 2 |
Synonyms: | CLTR2_HUMAN | CYSLT2 | CYSLT2R | CYSLTR2 | Cysteinyl leukotriene receptor | Cysteinyl leukotriene receptor 2 | Leukotriene Cysteinyl 2 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 39657.52 |
Organism: | Homo sapiens (Human) |
Description: | Leukotriene Cysteinyl 2 CYSLTR2 HUMAN::Q9NS75 |
Residue: | 346 |
Sequence: | MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSI
YVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYV
NMYSSIYFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQ
NGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRV
SHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACF
NPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV
|
|
|
BDBM50104911 |
---|
n/a |
---|
Name | BDBM50104911 |
Synonyms: | CHEMBL3597624 |
Type | Small organic molecule |
Emp. Form. | C36H38ClNO5 |
Mol. Mass. | 600.144 |
SMILES | Cc1c(CCCC(O)=O)c2cccc(C#Cc3ccc(OCCCCc4cccc(Cl)c4C)cc3)c2n1CCCC(O)=O |
Structure |
|