Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCysteinyl leukotriene receptor
LigandBDBM50009073
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1506470
IC50 1.9±n/a nM
Citation Itadani SYashiro KAratani YSekiguchi TKinoshita AMoriguchi HOhta NTakahashi SIshida ATajima YHisaichi KIma MUeda JEgashira HSekioka TKadode MYonetomi YNakao TInoue ANomura HKitamine TFujita MNabe TYamaura YMatsumura NImagawa ANakayama YTakeuchi JOhmoto K Discovery of Gemilukast (ONO-6950), a Dual CysLT1 and CysLT2 Antagonist As a Therapeutic Agent for Asthma. J Med Chem 58:6093-113 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cysteinyl leukotriene receptor
Name:Cysteinyl leukotriene receptor
Synonyms:CYSLTR1 | Cysteinyl leukotriene D4 receptor | Cysteinyl leukotriene receptor | HG55 | HMTMF81 | LTD4 receptor | Leukotriene Cysteinyl 1
Type:Enzyme Catalytic Domain
Mol. Mass.:38565.16
Organism:Homo sapiens (Human)
Description:Leukotriene Cysteinyl 1 CYSLTR1 HUMAN::Q9Y271
Residue:337
Sequence:
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQV
YMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFF
RCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDN
QTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTA
AFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGG
NFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009073
n/a
NameBDBM50009073
Synonyms:4-(5-cyclopentyloxycarbonylamino-1-methyl-1H-indol-3-ylmethyl)-3-methoxy-N-o-tolylsulfonylbenzamide | CHEMBL603 | ZAFIRLUKAST | cyclopentyl 3-(2-methoxy-4-((o-tolylsulfonyl)carbamoyl)benzyl)-1-methylindole-5-carbamate | cyclopentyl 3-[2-methoxy-4-(2-methylphenylsulfonylcarbamoyl)benzyl]-1-methyl-1H-indol-5-ylcarbamate
TypeSmall organic molecule
Emp. Form.C31H33N3O6S
Mol. Mass.575.675
SMILESCOc1cc(ccc1Cc1cn(C)c2ccc(NC(=O)OC3CCCC3)cc12)C(=O)NS(=O)(=O)c1ccccc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: