Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAminopeptidase N
LigandBDBM50353018
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1507526
Ki 0.060000±n/a nM
Citation Revelant GAl-Lakkis-Wehbe MSchmitt MAlavi SSchmitt CRoux LAl-Masri MSchifano-Faux NMaiereanu CTarnus CAlbrecht S Exploring S1 plasticity and probing S1' subsite of mammalian aminopeptidase N/CD13 with highly potent and selective aminobenzosuberone inhibitors. Bioorg Med Chem 23:3192-207 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Aminopeptidase N
Name:Aminopeptidase
Synonyms:Alanyl aminopeptidase | CD_antigen=CD13 | Microsomal aminopeptidase | Myeloid plasma membrane glycoprotein CD13 | gp150 | hAPN
Type:PROTEIN
Mol. Mass.:109522.63
Organism:Homo sapiens (Human)
Description:ChEMBL_1507526
Residue:967
Sequence:
MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPA
SATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVI
IIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDS
EFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHP
KDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLI
RIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLV
TYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYL
GADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKG
ASVLRMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIM
NRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDY
WLIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSAIPVINRAQ
IINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALSSLSYFKLMFDRSEVYGPMKN
YLKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEEMVSGLFKQWM
ENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWI
LNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSN
LIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQ
WFTENSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50353018
n/a
NameBDBM50353018
Synonyms:CHEMBL1821980 | CHEMBL1852660
TypeSmall organic molecule
Emp. Form.C17H16BrNO
Mol. Mass.330.219
SMILESNC1CCc2c(Br)ccc(-c3ccccc3)c2CC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: