Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeurokinin 1 receptor
LigandBDBM50106357
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1506611
IC50 1.1±n/a nM
Citation Degnan APTora GOHan YRajamani RBertekap RKrause RDavis CDHu JMorgan DTaylor SJKrause KLi YWMattson GCunningham MATaber MTLodge NJBronson JJGillman KWMacor JE Biaryls as potent, tunable dual neurokinin 1 receptor antagonists and serotonin transporter inhibitors. Bioorg Med Chem Lett 25:3039-43 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Neurokinin 1 receptor
Name:Neurokinin 1 receptor
Synonyms:NK-1 receptor | NK-1R | NK1 Receptor | Neurokinin NK1 | SPR | Substance-P receptor | TACR1 | Tachykinin receptor 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:46371.54
Organism:Rattus norvegicus (rat)
Description:Competition binding assays were carried out using membrane preparations from transfected CHO cells that constitutively expressed the rat NK1 receptor.
Residue:407
Sequence:
MDNVLPMDSDLFPNISTNTSESNQFVQPTWQIVLWAAAYTVIVVTSVVGNVVVIWIILAH
KRMRTVTNYFLVNLAFAEACMAAFNTVVNFTYAVHNVWYYGLFYCKFHNFFPIAALFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVIFVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNRTYEKAYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHVFFLLPYINPDLYLKKFIQQVYLASMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQSSVYKVSRLETTIST
VVGAHEEEPEEGPKATPSSLDLTSNGSSRSNSKTMTESSSFYSNMLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50106357
n/a
NameBDBM50106357
Synonyms:CHEMBL3596484
TypeSmall organic molecule
Emp. Form.C27H24F4N2O
Mol. Mass.468.4859
SMILESFc1cc(ccc1C#N)-c1cc(COCC2(CCNCC2)c2ccccc2)cc(c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: