Reaction Details |
 | Report a problem with these data |
Target | Neurokinin 1 receptor |
---|
Ligand | BDBM50108628 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1506611 |
---|
IC50 | 3.4±n/a nM |
---|
Citation | Degnan AP; Tora GO; Han Y; Rajamani R; Bertekap R; Krause R; Davis CD; Hu J; Morgan D; Taylor SJ; Krause K; Li YW; Mattson G; Cunningham MA; Taber MT; Lodge NJ; Bronson JJ; Gillman KW; Macor JE Biaryls as potent, tunable dual neurokinin 1 receptor antagonists and serotonin transporter inhibitors. Bioorg Med Chem Lett 25:3039-43 (2015) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Neurokinin 1 receptor |
---|
Name: | Neurokinin 1 receptor |
Synonyms: | NK-1 receptor | NK-1R | NK1 Receptor | Neurokinin NK1 | SPR | Substance-P receptor | TACR1 | Tachykinin receptor 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 46371.54 |
Organism: | Rattus norvegicus (rat) |
Description: | Competition binding assays were carried out using membrane preparations from transfected CHO cells that constitutively expressed the rat NK1 receptor. |
Residue: | 407 |
Sequence: | MDNVLPMDSDLFPNISTNTSESNQFVQPTWQIVLWAAAYTVIVVTSVVGNVVVIWIILAH
KRMRTVTNYFLVNLAFAEACMAAFNTVVNFTYAVHNVWYYGLFYCKFHNFFPIAALFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVIFVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNRTYEKAYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHVFFLLPYINPDLYLKKFIQQVYLASMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQSSVYKVSRLETTIST
VVGAHEEEPEEGPKATPSSLDLTSNGSSRSNSKTMTESSSFYSNMLA
|
|
|
BDBM50108628 |
---|
n/a |
---|
Name | BDBM50108628 |
Synonyms: | CHEMBL3596480 |
Type | Small organic molecule |
Emp. Form. | C28H30F3NO2 |
Mol. Mass. | 469.5385 |
SMILES | CCOc1ccc(cc1)-c1cc(COCC2(CCNCC2)c2ccccc2)cc(c1)C(F)(F)F |
Structure |
|