Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase 2 (Can2)
LigandBDBM10886
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1507855
Ki 23±n/a nM
Citation Ceruso MCarta FOsman SMAlothman ZMonti SMSupuran CT Inhibition studies of bacterial, fungal and protozoan▀-class carbonic anhydrases with Schiff bases incorporating sulfonamide moieties. Bioorg Med Chem 23:4181-7 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase 2 (Can2)
Name:Carbonic Anhydrase 2 (Can2)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:26594.37
Organism:Cryptococcus neoformans var. grubii (Filobasidiella neoformans var. grubii)
Description:n/a
Residue:239
Sequence:
MPFHAEPLKPSDEIDMDLGHSVAAQKFKEIREVLEGNRYWARKVTSEEPEFMAEQVKGQA
PNFLWIGCADSRVPEVTIMARKPGDVFVQRNVANQFKPEDDSSQALLNYAIMNVGVTHVM
VVGHTGCGGCIAAFDQPLPTEENPGGTPLVRYLEPIIRLKHSLPEGSDVNDLIKENVKMA
VKNVVNSPTIQGAWEQARKGEFREVFVHGWLYDLSTGNIVDLNVTQGPHPFVDDRVPRA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10886
n/a
NameBDBM10886
Synonyms:2-N-benzene-1,3,4-thiadiazole-2,5-disulfonamide | BZA1 | Benzolamide | Benzolamide (BZA) | CHEMBL73962
TypeSmall organic molecule
Emp. Form.C8H8N4O4S3
Mol. Mass.320.369
SMILESNS(=O)(=O)c1nnc(NS(=O)(=O)c2ccccc2)s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: