Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcyl-CoA:monoacylglycerol acyltransferase 2 (MOGAT2)
LigandBDBM159694
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1510039
IC50 164±n/a nM
Citation Busujima TTanaka HShirasaki YMunetomo ESaito MKitano KMinagawa TYoshida KOsaki NSato N Identification of 2-[2-(4-tert-butylphenyl)ethyl]-N-(4-fluorophenyl)-1,2,3,4-tetrahydroisoquinoline-6-sulfonamide (29) as an orally available MGAT2 inhibitor. Bioorg Med Chem 23:5922-31 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Acyl-CoA:monoacylglycerol acyltransferase 2 (MOGAT2)
Name:Acyl-CoA:monoacylglycerol acyltransferase 2 (MOGAT2)
Synonyms:2-acylglycerol O-acyltransferase 2 | Acyl-CoA:monoacylglycerol acyltransferase 2 | DC5 | DGAT2L5 | Diacylglycerol O-acyltransferase candidate 5 | Diacylglycerol acyltransferase 2-like protein 5 | MGAT2 | MOGAT2 | Monoacylglycerol Acyltransferase 2 (MGAT2) | Monoacylglycerol O-acyltransferase 2 | hDC5 | hMGAT2
Type:Enzyme
Mol. Mass.:38210.80
Organism:Homo sapiens (Human)
Description:Q3SYC2
Residue:334
Sequence:
MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLD
RDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFAN
LCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNL
LGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGENDLFDQIPNSSG
SWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEE
VNQLHQRYIKELCNLFEAHKLKFNIPADQHLEFC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM159694
n/a
NameBDBM159694
Synonyms:US9035059, 14-16
TypeSmall organic molecule
Emp. Form.C26H28FN3O4S
Mol. Mass.497.582
SMILESCOc1ccc(NS(=O)(=O)c2ccc3CN(Cc3c2)C(=O)Nc2ccc(cc2)C(C)(C)C)c(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: