| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Eukaryotic translation initiation factor 4E |
|---|
| Ligand | BDBM50110845 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1511842 (CHEMBL3608168) |
|---|
| IC50 | 25000±n/a nM |
|---|
| Citation |  Ziemniak, M; Kowalska, J; Lukaszewicz, M; Zuberek, J; Wnek, K; Darzynkiewicz, E; Jemielity, J Phosphate-modified analogues of m(7)GTP and m(7)Gppppm(7)G-Synthesis and biochemical properties. Bioorg Med Chem23:5369-81 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Eukaryotic translation initiation factor 4E |
|---|
| Name: | Eukaryotic translation initiation factor 4E |
|---|
| Synonyms: | EIF4E | IF4E_RABIT |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 25047.40 |
|---|
| Organism: | Oryctolagus cuniculus |
|---|
| Description: | ChEMBL_1511842 |
|---|
| Residue: | 217 |
|---|
| Sequence: | MATVEPETTPTPNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
|
|
|
|---|
| BDBM50110845 |
|---|
| n/a |
|---|
| Name | BDBM50110845 |
|---|
| Synonyms: | CHEMBL3351000 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H29N10O18P3 |
|---|
| Mol. Mass. | 802.4324 |
|---|
| SMILES | C[n+]1cn([C@@H]2O[C@H](COP(O)(=O)OP([O-])(=O)OP(O)(=O)OC[C@H]3O[C@H]([C@H](O)[C@@H]3O)n3cnc4c3nc(N)[nH]c4=O)[C@@H](O)[C@H]2O)c2nc(N)[nH]c(=O)c12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
