Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIsocitrate dehydrogenase [NADP] cytoplasmic
LigandBDBM50111800
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1510683
Ki 4600±n/a nM
Citation Wu FJiang HZheng BKogiso MYao YZhou CLi XNSong Y Inhibition of Cancer-Associated Mutant Isocitrate Dehydrogenases by 2-Thiohydantoin Compounds. J Med Chem 58:6899-908 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Isocitrate dehydrogenase [NADP] cytoplasmic
Name:Isocitrate dehydrogenase [NADP] cytoplasmic
Synonyms:Cytosolic NADP-isocitrate dehydrogenase | IDH | IDH1 | IDP | Isocitrate Dehydrogenase (IDH1) | Isocitrate dehydrogenase 1 (IDH1) | NADP(+)-specific ICDH | Oxalosuccinate decarboxylase | PICD
Type:Protein
Mol. Mass.:46661.29
Organism:Homo sapiens (Human)
Description:O75874
Residue:414
Sequence:
MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE
EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50111800
n/a
NameBDBM50111800
Synonyms:CHEMBL3605388
TypeSmall organic molecule
Emp. Form.C17H15N3O2S
Mol. Mass.325.385
SMILESCN1C(=S)N\C(=C\c2ccc(=O)n(Cc3ccccc3)c2)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: