Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDiscoidin domain-containing receptor 2
LigandBDBM50112613
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1513724
IC50 280±n/a nM
Citation Murray CWBerdini VBuck IMCarr MECleasby ACoyle JECurry JEDay JEDay PJHearn KIqbal ALee LYMartins VMortenson PNMunck JMPage LWPatel SRoomans SSmith KTamanini ESaxty G Fragment-Based Discovery of Potent and Selective DDR1/2 Inhibitors. ACS Med Chem Lett 6:798-803 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Discoidin domain-containing receptor 2
Name:Discoidin domain-containing receptor 2
Synonyms:Discoidin domain receptor 2 (DDR2) | Discoidin domain-containing receptor 2 (DDR2) | Epithelial discoidin domain-containing receptor 2 (DDR2)
Type:Protein
Mol. Mass.:96717.07
Organism:Homo sapiens (Human)
Description:n/a
Residue:855
Sequence:
MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKY
GRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKI
NYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRV
ELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDGAVGYSMTEGLGQLTDGVSGLD
DFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFK
EVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFS
EITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL
WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFPLRPD
YQEPSRLIRKLPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSV
PAVTMDLLSGKDVAVEEFPRKLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSAN
QPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIHLLAVCITDDPLCMITEYMENG
DLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGK
NYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWET
FTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP
SFQEIHLLLLQQGDE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50112613
n/a
NameBDBM50112613
Synonyms:CHEMBL3608784
TypeSmall organic molecule
Emp. Form.C22H19N5O2
Mol. Mass.385.4186
SMILESO=C(NCc1cccc(NC(=O)c2cnc3ccccn23)c1)Nc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: