Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocyte-stimulating hormone receptor
LigandBDBM50027084
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1508784
EC50 110±n/a nM
Citation Cai MMarelli UKBao JBeck JGOpperer FRechenmacher FMcLeod KRZingsheim MRDoedens LKessler HHruby VJ Systematic Backbone Conformational Constraints on a Cyclic Melanotropin Ligand Leads to Highly Selective Ligands for Multiple Melanocortin Receptors. J Med Chem 58:6359-67 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Melanocyte-stimulating hormone receptor
Name:Melanocortin receptor (M1 and M4)
Synonyms:MC1-R | MSH-R | Melanocortin MC1 | Melanocortin receptor 1 (MC-1) | Melanocortin receptor 1 (MC1-R) | Melanocortin receptor 1 (MC1R)
Type:Enzyme
Mol. Mass.:34717.23
Organism:Homo sapiens (Human)
Description:Q01726
Residue:317
Sequence:
MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVV
ATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVI
DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFI
AYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGA
VTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF
HSQELRRTLKEVLTCSW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50027084
n/a
NameBDBM50027084
Synonyms:MELATONAN | Melatonan
TypeSmall organic molecule
Emp. Form.C50H69N15O9
Mol. Mass.1024.178
SMILESCCCC[C@H](NC(C)=O)C(=O)N[C@H]1CC(=O)NCCCC[C@H](NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](Cc2ccccc2)NC(=O)[C@H](Cc2cnc[nH]2)NC1=O)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: