Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin G/H synthase (Cyclooxygenase-2)
LigandBDBM17638
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1513801
Ki 9860±n/a nM
Citation Banerjee AGDas NShengule SASrivastava RSShrivastava SK Synthesis, characterization, evaluation and molecular dynamics studies of 5, 6-diphenyl-1,2,4-triazin-3(2H)-one derivatives bearing 5-substituted 1,3,4-oxadiazole as potential anti-inflammatory and analgesic agents. Eur J Med Chem 101:81-95 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin G/H synthase (Cyclooxygenase-2)
Name:Prostaglandin G/H synthase (cyclooxygenase)
Synonyms:Cyclooxygenase-1 (COX-1) | Cyclooxygenase-2 (COX-2)
Type:Protein
Mol. Mass.:68976.98
Organism:Ovis aries (Sheep)
Description:n/a
Residue:603
Sequence:
MLARALLLCAAVVCGAANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCTTPEFLT
RIKLLLKPTPDTVHYILTHFKGVWNIVNKISFLRNMIMRYVLTSRSHLIESPPTYNVHYS
YKSWEAFSNLSYYTRALPPVPDDCPTPMGVKGRKELPDSKEVVKKVLLRRKFIPDPQGTN
LMFAFFAQHFTHQFFKTDIERGPAFTKGKNHGVDLSHVYGESLERQHNRRLFKDGKMKYQ
MINGEMYPPTVKDTQVEMIYPPHIPEHLKFAVGQEVFGLVPGLMMYATIWLREHNRVCDV
LKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQN
RIAAEFNTLYHWHPLLPDVFQIDGQEYNYQQFIYNNSVLLEHGVTQFVESFTRQIAGRVA
GRRNLPAAVEKVSKASLDQSREMKYQSFNEYRKRFLLKPYESFEELTGEKEMAAELEALY
GDIDAMELYPALLVEKPAPDAIFGETMVEAGAPFSLKGLMGNPICSPEYWKPSTFGGEVG
FKIINTASIQSLICSNVKGCPFTSFSVQDAHLTKTVTINASSSHSGLDDINPTVLLKERS
TEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17638
n/a
NameBDBM17638
Synonyms:2-{1-[(4-chlorophenyl)carbonyl]-5-methoxy-2-methyl-1H-indol-3-yl}acetic acid | CHEMBL6 | Indocin | Indomethacin | US9271961, Indomethacin | indometacin
TypeSmall organic molecule
Emp. Form.C19H16ClNO4
Mol. Mass.357.788
SMILESCOc1ccc2n(C(=O)c3ccc(Cl)cc3)c(C)c(CC(O)=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: