Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 4 (mGlu4)
LigandBDBM50293743
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1512614
EC50 330±n/a nM
Citation Zhang ZKil KEPoutiainen PChoi JKKang HJHuang XPRoth BLBrownell AL Re-exploring the N-phenylpicolinamide derivatives to develop mGlu4 ligands with improved affinity and in vitro microsomal stability. Bioorg Med Chem Lett 25:3956-60 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Metabotropic glutamate receptor 4 (mGlu4)
Name:Metabotropic glutamate receptor
Synonyms:GRM4 | Metabotropic glutamate receptor | mGlu4 | metabotropic glutamate 4 | metabotropic glutamate 4a
Type:Enzyme
Mol. Mass.:101849.79
Organism:Rattus norvegicus (Rat)
Description:P31423
Residue:912
Sequence:
MSGKGGWAWWWARLPLCLLLSLYAPWVPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGR
GSEGKACGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSL
TFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYA
STAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTLASEGSYGESGVEAFIQ
KSRENGGVCIAQSVKIPREPKTGEFDKIIKRLLETSNARGIIIFANEDDIRRVLEAARRA
NQTGHFFWMGSDSWGSKSAPVLRLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNRRNI
WFAEFWEDNFHCKLSRHALKKGSHIKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQY
QLRNGSAEYKVIGSWTDHLHLRIERMQWPGSGQQLPRSICSLPCQPGERKKTVKGMACCW
HCEPCTGYQYQVDRYTCKTCPYDMRPTENRTSCQPIPIVKLEWDSPWAVLPLFLAVVGIA
ATLFVVVTFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLG
LGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFILISLQLLGICVWFVV
DPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPET
FNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLETPALAT
KQTYVTYTNHAI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50293743
n/a
NameBDBM50293743
Synonyms:CHEMBL556667 | N-(3-chlorophenyl)picolinamide | cid_836002
TypeSmall organic molecule
Emp. Form.C12H9ClN2O
Mol. Mass.232.666
SMILESClc1cccc(NC(=O)c2ccccn2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: