Reaction Details |
| Report a problem with these data |
Target | ATP-sensitive inward rectifier potassium channel 10 |
---|
Ligand | BDBM155928 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1515521 (CHEMBL3615702) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Walsh, SP; Shahripour, A; Tang, H; Teumelsan, N; Frie, J; Zhu, Y; Priest, BT; Swensen, AM; Liu, J; Margulis, M; Visconti, R; Weinglass, A; Felix, JP; Brochu, RM; Bailey, T; Thomas-Fowlkes, B; Alonso-Galicia, M; Zhou, X; Pai, LY; Corona, A; Hampton, C; Hernandez, M; Bentley, R; Chen, J; Shah, K; Metzger, J; Forrest, M; Owens, K; Tong, V; Ha, S; Roy, S; Kaczorowski, GJ; Yang, L; Parmee, E; Garcia, ML; Sullivan, K; Pasternak, A Discovery of a Potent and Selective ROMK Inhibitor with Pharmacokinetic Properties Suitable for Preclinical Evaluation. ACS Med Chem Lett6:747-52 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
ATP-sensitive inward rectifier potassium channel 10 |
---|
Name: | ATP-sensitive inward rectifier potassium channel 10 |
Synonyms: | ATP-dependent inwardly rectifying potassium channel Kir4.1 | Inward rectifier K(+) channel Kir1.2 | KCJ10_HUMAN | KCNJ10 | Potassium channel, inwardly rectifying subfamily J member 10 |
Type: | PROTEIN |
Mol. Mass.: | 42513.64 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_105175 |
Residue: | 379 |
Sequence: | MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFI
DMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFL
FSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIR
FSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQV
DTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSY
LPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEES
LREQAEKEGSALSVRISNV
|
|
|
BDBM155928 |
---|
n/a |
---|
Name | BDBM155928 |
Synonyms: | US9018211, 52 |
Type | Small organic molecule |
Emp. Form. | C24H28N4O5 |
Mol. Mass. | 452.5029 |
SMILES | COc1cc(ncc1C#N)[C@@H](O)CN1CCN(C[C@H](O)c2ccc3C(=O)OCc3c2C)CC1 |r| |
Structure |
|