Reaction Details |
| Report a problem with these data |
Target | ATP-sensitive inward rectifier potassium channel 1 |
---|
Ligand | BDBM50116826 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1515501 (CHEMBL3615682) |
---|
IC50 | 120±n/a nM |
---|
Citation | Walsh, SP; Shahripour, A; Tang, H; Teumelsan, N; Frie, J; Zhu, Y; Priest, BT; Swensen, AM; Liu, J; Margulis, M; Visconti, R; Weinglass, A; Felix, JP; Brochu, RM; Bailey, T; Thomas-Fowlkes, B; Alonso-Galicia, M; Zhou, X; Pai, LY; Corona, A; Hampton, C; Hernandez, M; Bentley, R; Chen, J; Shah, K; Metzger, J; Forrest, M; Owens, K; Tong, V; Ha, S; Roy, S; Kaczorowski, GJ; Yang, L; Parmee, E; Garcia, ML; Sullivan, K; Pasternak, A Discovery of a Potent and Selective ROMK Inhibitor with Pharmacokinetic Properties Suitable for Preclinical Evaluation. ACS Med Chem Lett6:747-52 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
ATP-sensitive inward rectifier potassium channel 1 |
---|
Name: | ATP-sensitive inward rectifier potassium channel 1 |
Synonyms: | ATP-regulated potassium channel ROM-K | ATP-regulated potassium channel ROMK | ATP-sensitive inward rectifier potassium channel 1 | Egl nine homolog 1 | KCNJ1 | KCNJ1_HUMAN | Potassium channel (ATP modulatory) | Potassium inwardly-rectifying channel, subfamily J, member 1 | ROMK1 | Renal Outer Medullary Potassium (ROMK1) | The Renal Outer Medullary Potassium (ROMK) |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 44809.08 |
Organism: | Homo sapiens (Human) |
Description: | gi_223460826 |
Residue: | 391 |
Sequence: | MNASSRNVFDTLIRVLTESMFKHLRKWVVTRFFGHSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTP
CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
NEKDVRARMKRGYDNPNFILSEVNETDDTKM
|
|
|
BDBM50116826 |
---|
n/a |
---|
Name | BDBM50116826 |
Synonyms: | CHEMBL3612799 |
Type | Small organic molecule |
Emp. Form. | C25H29N3O4 |
Mol. Mass. | 435.5155 |
SMILES | COc1cc(CCN2CCN(CC(O)c3ccc4C(=O)OCc4c3C)CC2)ccc1C#N |
Structure |
|