Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLIM domain kinase 2
LigandBDBM50117489
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1514398
IC50<1±n/a nM
Citation Boland SBourin AAlen JGeraets JSchroeders PCastermans KKindt NBoumans NPanitti LVanormelingen JFransen SVan de Velde SDefert O Design, synthesis and biological characterization of selective LIMK inhibitors. Bioorg Med Chem Lett 25:4005-10 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
LIM domain kinase 2
Name:LIM domain kinase 2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:72238.81
Organism:Homo sapiens (Human)
Description:ChEMBL_1514398
Residue:638
Sequence:
MSALAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSCFRCSECQDSLTNWYYEKDGKLYC
PKDYWGKFGEFCHGCSLLMTGPFMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLY
CGKCHNEVVLAPMFERLSTESVQEQLPYSVTLISMPATTEGRRGFSVSVESACSNYATTV
QVKEVNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAISQTSQTLQLLIEHDPV
SQRLDQLRLEARLAPHMQNAGHPHALSTLDTKENLEGTLRRRSLRRSNSISKSPGPSSPK
EPLLFSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMK
ELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSM
DPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEER
KRAPMEKATTKKRTLRKNDRKKRYTVVGNPYWMAPEMLNGKSYDETVDIFSFGIVLCEII
GQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCRLEPESRPAFSKLEDS
FEALSLYLGELGIPLPAELEELDHTVSMQYGLTRDSPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50117489
n/a
NameBDBM50117489
Synonyms:CHEMBL3613598
TypeSmall organic molecule
Emp. Form.C22H26N6O3
Mol. Mass.422.4802
SMILESCOC(=O)c1cccc(NC(=O)C2(CN)CCN(CC2)c2ncnc3[nH]cc(C)c23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: