Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
LigandBDBM50117665
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1515029
IC50 19953±n/a nM
Citation Huard KLondregan ATTesz GBahnck KBMagee TVHepworth DPolivkova JCoffey SBPabst BAGosset JRNigam AKou KSun HLee KHerr MBoehm MCarpino PAGoodwin BPerreault CLi QJorgensen CCTkalcevic GTSubashi TAAhn K Discovery of Selective Small Molecule Inhibitors of Monoacylglycerol Acyltransferase 3. J Med Chem 58:7164-72 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
Name:Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
Synonyms:Beta-1,2-N-acetylglucosaminyltransferase II | GNT-II | GlcNAc-T II | MGAT2 | Mannoside acetylglucosaminyltransferase 2 | Monoacylglycerol acyltransferase 2 (MGAT2) | Monoacylglycerol acyltransferase type 2 (h-MGAT2) | N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase II | h-MGAT2 (human monoacylglycerol acyltransferase type 2)
Type:n/a
Mol. Mass.:51567.80
Organism:Homo sapiens (Human)
Description:Q10469
Residue:447
Sequence:
MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKNEALAPPLLDAEPARGAGGRGGDHPSV
AVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVL
VVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSHDFWSTEINQLIAGVNFCPVLQVFFPFS
IQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHF
VWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF
YGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDTFCTYDDYNWDWTLQYLTVSCLPK
FWKVLVPQIPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTVV
AISPPRKNGGWGDIRDHELCKSYRRLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50117665
n/a
NameBDBM50117665
Synonyms:CHEMBL3613709
TypeSmall organic molecule
Emp. Form.C23H25N5O4S
Mol. Mass.467.541
SMILESCOc1cccc(CC(=O)N2Cc3ccc(cc3C2)S(=O)(=O)Nc2cnn(n2)C2CCC2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: