| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50118187 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1514756 (CHEMBL3614957) |
|---|
| Ki | 60±n/a nM |
|---|
| Citation |  Nakajima, R; Yamamoto, N; Hirayama, S; Iwai, T; Saitoh, A; Nagumo, Y; Fujii, H; Nagase, H Synthesis of new opioid derivatives with a propellane skeleton and their pharmacologies: Part 5, novel pentacyclic propellane derivatives with a 6-amide side chain. Bioorg Med Chem23:6271-9 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50118187 |
|---|
| n/a |
|---|
| Name | BDBM50118187 |
|---|
| Synonyms: | CHEMBL3613281 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H39ClN2O2 |
|---|
| Mol. Mass. | 507.107 |
|---|
| SMILES | Cl.[H][C@]12CC[C@]3([H])N(CC4CC4)CC[C@@]4(C[C@@H]1N(C)C(=O)Cc1ccccc1)c1cc(O)ccc1C[C@@]34C2 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
