| Reaction Details |
|---|
 | Report a problem with these data |
| Target | CCR4-NOT transcription complex subunit 7 |
|---|
| Ligand | BDBM50119651 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1518114 (CHEMBL3619397) |
|---|
| IC50 | 10400±n/a nM |
|---|
| Citation |  Jadhav, GP; Kaur, I; Maryati, M; Airhihen, B; Fischer, PM; Winkler, GS Discovery, synthesis and biochemical profiling of purine-2,6-dione derivatives as inhibitors of the human poly(A)-selective ribonuclease Caf1. Bioorg Med Chem Lett25:4219-24 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| CCR4-NOT transcription complex subunit 7 |
|---|
| Name: | CCR4-NOT transcription complex subunit 7 |
|---|
| Synonyms: | BTG1-binding factor 1 | CAF-1 | CAF1 | CCR4-NOT transcription complex subunit 7 | CCR4-associated factor 1 | CNOT7 | CNOT7_HUMAN | Caf1a |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32730.66 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_109881 |
|---|
| Residue: | 285 |
|---|
| Sequence: | MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADY
QYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSG
IQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELD
FFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFK
MREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS
|
|
|
|---|
| BDBM50119651 |
|---|
| n/a |
|---|
| Name | BDBM50119651 |
|---|
| Synonyms: | CHEMBL3616505 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H10N4O3 |
|---|
| Mol. Mass. | 258.2328 |
|---|
| SMILES | On1c(=O)[nH]c2ncn(Cc3ccccc3)c2c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
