Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGPR24
LigandBDBM50120630
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1518193
Ki 5.5±n/a nM
Citation Devasthale PWang WMignone JRenduchintala KRadhakrishnan SDhanapal JSelvaraj JKuppusamy RPelleymounter MALonghi DHuang NFlynn NAzzara AVRohrbach KDevenny JRooney SThomas MGlick SGodonis HHarvey SCullen MJZhang HCaporuscio CStetsko PGrubb MHuang CZhang LFreeden CMurphy BJRobl JAWashburn WN Non-basic azolotriazinone MCHR1 antagonists for the treatment of obesity: An empirical brain-exposures-driven candidate selection for in vivo efficacy studies. Bioorg Med Chem Lett 25:4412-8 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
GPR24
Name:GPR24
Synonyms:Melanin Concentrating Hormone 1 | Melanin-concentrating hormone receptor | Melanin-concentrating hormone receptor 1
Type:Enzyme Catalytic Domain
Mol. Mass.:39740.39
Organism:RAT
Description:Melanin Concentrating Hormone 1 GPR24 RAT::P97639
Residue:360
Sequence:
QATCTGCMDLQTSLLSTGPNASNISDGQDNLTLPGSPPRTGSVSYINIIMPSVFGTICLL
GIVGNSTVIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGE
TMCTLITAMDANSQFTSTYILTAMTIDRYLATVHPISSTKFRKPSMATLVICLLWALSFI
SITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVKILQ
RMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLY
NAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTESKGT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50120630
n/a
NameBDBM50120630
Synonyms:CHEMBL3618332
TypeSmall organic molecule
Emp. Form.C21H18ClN5O2
Mol. Mass.407.853
SMILESO[C@@H]1CCN(C1)c1ccc(cn1)-n1cnn2cc(cc2c1=O)-c1ccc(Cl)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: