Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase Fyn
LigandBDBM50121391
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1518811
IC50 10±n/a nM
Citation Hart ACSchroeder GMWan HGrebinski JInghrim JKempson JGuo JPitts WJTokarski JSSack JSKhan JALippy JLorenzi MVYou DMcDevitt TVuppugalla RZhang YLombardo LJTrainor GLPurandare AV Structure-Based Design of Selective Janus Kinase 2 Imidazo[4,5-d]pyrrolo[2,3-b]pyridine Inhibitors. ACS Med Chem Lett 6:845-9 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase Fyn
Name:Tyrosine-protein kinase Fyn
Synonyms:FYN | Proto-oncogene Syn | Proto-oncogene c-Fyn | SLK | Src-like kinase | p59-Fyn
Type:Enzyme
Mol. Mass.:60762.21
Organism:Homo sapiens (Human)
Description:P06241
Residue:537
Sequence:
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50121391
n/a
NameBDBM50121391
Synonyms:CHEMBL3622137
TypeSmall organic molecule
Emp. Form.C23H27N7OS
Mol. Mass.449.572
SMILESCCn1c(cc2c1nc(Nc1nc(C)c(C)s1)c1ncn(C)c21)C(=O)N(C1CC1)C1CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: