Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD-Aspartate Oxidase (DDO)
LigandBDBM50121997
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1517179
IC50>100000±n/a nM
Citation Katane MYamada SKawaguchi GChinen MMatsumura MAndo TDoi INakayama KKaneko YMatsuda SSaitoh YMiyamoto TSekine MYamaotsu NHirono SHomma H Identification of Novel D-Aspartate Oxidase Inhibitors by in Silico Screening and Their Functional and Structural Characterization in Vitro. J Med Chem 58:7328-40 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
D-Aspartate Oxidase (DDO)
Name:D-Aspartate Oxidase (DDO)
Synonyms:DASOX
Type:Oxidoreductase
Mol. Mass.:37543.06
Organism:Homo sapiens (Human)
Description:Recombinant human DDO expressed and purified from sf9 insect cells, was used in enzyme assays.
Residue:341
Sequence:
MDTARIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDTTSDVAAGMLIPHTYPDTP
IHTQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMT
EAELKKFPQYVFGQAFTTLKCECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHPSFDIVV
NCSGLGSRQLAGDSKIFPVRGQVLQVQAPWVEHFIRDGSGLTYIYPGTSHVTLGGTRQKG
DWNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPV
VHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50121997
n/a
NameBDBM50121997
Synonyms:CHEMBL3322863
TypeSmall organic molecule
Emp. Form.C6H6N2O2
Mol. Mass.138.124
SMILESNc1cccc(n1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: