Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPregnane X receptor (PXR)
LigandBDBM50122318
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1519130
EC50>50000±n/a nM
Citation Wan HSchroeder GMHart ACInghrim JGrebinski JTokarski JSLorenzi MVYou DMcdevitt TPenhallow BVuppugalla RZhang YGu XIyer RLombardo LJTrainor GLRuepp SLippy JBlat YSack JSKhan JAStefanski KSleczka BMathur ASun JHWong MKWu DRLi PGupta AArunachalam PNPragalathan BNarayanan SK C NKuppusamy PPurandare AV Discovery of a Highly Selective JAK2 Inhibitor, BMS-911543, for the Treatment of Myeloproliferative Neoplasms. ACS Med Chem Lett 6:850-5 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Pregnane X receptor (PXR)
Name:Pregnane X receptor
Synonyms:Pregnane X Receptor | nuclear receptor subfamily 1 group I member 2 isoform 1
Type:Nuclear receptor
Mol. Mass.:49774.77
Organism:Homo sapiens (Human)
Description:O75469
Residue:434
Sequence:
MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEG
CKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEE
RRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSS
GCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLL
PHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWE
CGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHR
VVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPF
ATPLMQELFGITGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50122318
n/a
NameBDBM50122318
Synonyms:BMS-911543
TypeSmall organic molecule
Emp. Form.C23H28N8O
Mol. Mass.432.5214
SMILESCCn1c(cc2c1nc(Nc1cc(C)n(C)n1)c1ncn(C)c21)C(=O)N(C1CC1)C1CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: