Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLIM domain kinase 1
LigandBDBM50124397
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1520363
IC50 1500±n/a nM
Citation Charles MDBrookfield JLEkwuru TCStockley MDunn JRiddick MHammonds TTrivier EGreenland GWong ACCheasty ABoyd SCrighton DOlson MF Discovery, Development, and SAR of Aminothiazoles as LIMK Inhibitors with Cellular Anti-Invasive Properties. J Med Chem 58:8309-13 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
LIM domain kinase 1
Name:LIM domain kinase 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:72591.81
Organism:Homo sapiens (Human)
Description:gi_4505001
Residue:647
Sequence:
MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLS
HQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGD
GDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSV
SIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEID
LLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSID
RSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRE
TGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGT
LRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFG
LARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLC
EIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKL
EHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50124397
n/a
NameBDBM50124397
Synonyms:CHEMBL3623435
TypeSmall organic molecule
Emp. Form.C18H18ClN3S
Mol. Mass.343.874
SMILESCC(C)CNc1ncc(s1)-c1ccncc1-c1ccccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: