Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProgesterone receptor
LigandBDBM20607
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1519264
IC50 129±n/a nM
Citation De Savi CBradbury RHRabow AANorman RAde Almeida CAndrews DMBallard PButtar DCallis RJCurrie GSCurwen JODavies CDDonald CSFeron LJGingell HGlossop SCHayter BRHussain SKaroutchi GLamont SGMacFaul PMoss TAPearson SETonge MWalker GEWeir HMWilson Z Optimization of a Novel Binding Motif to (E)-3-(3,5-Difluoro-4-((1R,3R)-2-(2-fluoro-2-methylpropyl)-3-methyl-2,3,4,9-tetrahydro-1H-pyrido[3,4-b]indol-1-yl)phenyl)acrylic Acid (AZD9496), a Potent and Orally Bioavailable Selective Estrogen Receptor Downregulator and Antagonist. J Med Chem 58:8128-40 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Progesterone receptor
Name:Progesterone receptor
Synonyms:Nuclear receptor subfamily 3 group C member 3 | PR | progesterone
Type:Protein
Mol. Mass.:98979.52
Organism:Homo sapiens (Human)
Description:P06401
Residue:933
Sequence:
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLF
PRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLA
PSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAA
AHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGK
PRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTV
MDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPD
CAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLG
PPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPC
KAPGASGCLLPRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPP
YLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHN
YLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVVRALDAVALPQPV
GVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQ
LGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAP
DLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQ
FEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRA
LSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM20607
n/a
NameBDBM20607
Synonyms:(2-{4-[(1Z)-1,2-diphenylbut-1-en-1-yl]phenoxy}ethyl)dimethylamine | 2-{4-[(1Z)-1,2-diphenylbut-1-en-1-yl]phenoxy}-N,N-dimethylethanamine | CHEMBL83 | FOSTRIECIN SODIUM | NCGC00024928 | Nolvadex | Tamoxifen | Tamoxifen (8) | Tamoxifen, 7 | cid_2733526
TypeSmall organic molecule
Emp. Form.C26H29NO
Mol. Mass.371.5146
SMILESCC\C(=C(/c1ccccc1)c1ccc(OCCN(C)C)cc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: